Skip to content
Government and ministries

Näringsminister Lintilä: Satsningarna i tilläggsbudgeten stöder företagen i återhämtningen efter coronakrisen

Arbets- och näringsministeriet
27.5.2021 11.11
Pressmeddelande

Tillväxten påskyndas, investeringar tidigareläggs samt de utgiftsbehov som uppstår till följd av coronaviruset möts i den tredje tilläggsbudgeten för 2021. Genom tilläggsbudgeten inleds också reformer och investeringar inom ramen för EU:s återhämtningsinstrument.

– De goda utsikterna för ekonomin och investeringarna ändrar inte på det faktum att alltför många finländska företagare och arbetstagare i företag har blivit tvungna att bära en orimligt stor börda på grund av coronan. Det är förståeligt att framtidstron har varit satt på prov. På grund av det här fattade vi viktiga beslut för att trygga tillväxt, företag som sysselsätter och finländska arbetsplatser i samband med den tredje tilläggsbudgeten för det här året, säger näringsminister Mika Lintilä.

Genom den fjärde ansökningsomgången för kostnadsstöd stöds de branscher som lidit mest på grund av corona

En fjärde ansökningsomgång för kostnadsstöd är under beredning. I tilläggsbudgeten reserveras en tilläggsfinansiering på 200 miljoner euro för kostnadsstödet. Av den här helheten är nästan 170 miljoner euro en ombudgetering till kostnadsstödet av det oanvända anslaget för stöd till ensamföretagare 2020.

Syftet med kostnadsstödet för företag är att hjälpa företagen att klara sig i den svåra ekonomiska situationen till följd av coronapandemin. Stödet ersätter företagens fasta kostnader som är svåra att anpassa och lönekostnaderna, men stödet ersätter inte minskad omsättning. 

Ytterligare satsningar på att stödja batterivärdeskedjan

Avsikten är att batteribranschen ska sysselsätta och åstadkomma tillväxt på olika håll i Finland.
Finansieringen till batteribranschen ökas med 40 miljoner euro genom finansiering i form av understöd från Business Finland. Finansieringen främjar pilot- och demonstrationsprojekt i batteribranschen som stöder Finlands nationella mål samt cirkulär ekonomi och produktiva investeringar i hållbar grön tillväxt. 

Beredskap inför Finnveras risker för förlust

Det föreslås att 650 miljoner euro överförs till Statsgarantifonden. Därigenom bereder man sig på en situation där de tillgångar som finns kvar i statsgarantifonden inte räcker till för att täcka det förlustbringande separata resultatet av Finnvera Abp:s exportgaranti- och specialfinansieringsverksamhet. Genom reserveringen stärks verksamhetsförutsättningarna inom marinindustrin som sysselsätter tusentals människor och en stor mängd finländska underleverantörer. 


Ökat innovationsstöd för skeppsbyggnad

Det föreslås att innovationsstödet för skeppsbyggnad ökas med 19,4 miljoner euro. Ökningen gör det möjligt att stödja nya projekt och gör det möjligt att höja det maximala beloppet på innovationsstödet från 10 miljoner euro till 15 miljoner euro.

Företagare och arbetstagare i torvbranschen ska stödjas 


Tilläggsbudgeten innehåller en stödhelhet på 60 miljoner som ska stöda företagare och arbetstagare i torvbranschen.

– Den helhet som man kommit överens om innebär att så många som möjligt som får sin inkomst från branschen ska kunna anpassa sig till en snabb strukturomvandling på ett rättvist sätt, säger minister Lintilä.

Finansieringen består av följande delar:

  • Statsunderstöd på 20 miljoner till att flytta eller skrota torvproduktionsmaskiner.
  • Tre miljoner euro till att stödja och understöda ny, ersättande verksamhet för torvföretagarna.
  • 1,5 miljoner euro till omskolning och övriga åtgärder som främjar sysselsättning för företagare och arbetstagare i branschen. 
  • 30,585 miljoner euro betalas till torvföretagarna som understöd eller annan anpassningspenning.
  • Fyra miljoner euro till stöd för beskogning. 
  • 0,75 miljoner euro till en utredning av alternativa sätt att använda torvproduktionsområden i framtiden och till ett informationspaket. 
  • Sammanlagt 0,165 miljoner euro till att ställa resurser till förfogande för stödåtgärder vid arbets- och näringsbyråerna och Närings-, trafik- och miljöcentralerna.

Stöd till tågtrafiken

I enlighet med programmet Hållbar turism 2030 höjer kommunikationsministeriet servicenivån på nattrafiken i det köpavtal om persontågtrafiken som förhandlas med VR och som varar i högst nio år. I tilläggsbudgetpropositionen ingår ett mandat att skaffa nya vagnar till nattågen för 40 miljoner euro.

Stöd till vaccinutveckling

Verkställandet av tillväxtstrategin för hälsobranschen och vaccinutvecklingen stöds genom att finansiering i form av understöd från Business Finland läggs till i den här helheten med sex miljoner euro.

Tilläggsbudgetpropositionen överlämnades till riksdagen torsdagen den 27 maj. Propositionen finns att läsa i sin helhet på adressen budjetti.vm.fi.


Mer information:
Antti Siika-aho, näringsministerns specialmedarbetare, tfn 050 575 4118
Teppo Säkkinen, näringsministerns specialmedarbetare, tfn 050 516 2868 (särskilt stödet till torvbranschen)
Mika Niemelä, direktör, arbets- och näringsministeriet, tfn 029 506 2135


 

Back to top